DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and asb1

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_001002736.1	Gene:	asb1 / 554673	ZFINID:	ZDB-GENE-040718-234	Length:	334	Species:	Danio rerio

Alignment Length:	140	Identity:	40/140 - (28%)
Similarity:	62/140 - (44%)	Gaps:	14/140 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 DDADELIEEDKNPQSSIERMILW------------AVNENRISEVREILKLDADTVNAKDNDGYT 84
            |....|::||...| .|.:.::|            |....|...|..::...|| |:..|..|.|
Zfish    50 DTLRTLLQEDCFRQ-RINQKLIWSCGLLPCTPLCIAAMMGRSDCVAFLISQGAD-VDLVDVKGQT 112

  Fly    85 PLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQ 149
            .|..|..|..:|..||||:..|:||.......||::.|.:...||....|::|.|||:.:...:|
Zfish   113 ALFMAVVNGHLDCVKLLLEAGADPNGSRHHRSTPIYHAAQVGRADIMLELIRFHADVDIDHRLEQ 177

  Fly   150 TPLHITATVS 159
            ..:..|.|::
Zfish   178 KVIFRTRTLT 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	7/38 (18%)
		ANK	54..169	CDD:238125	34/118 (29%)
		Ank_5	67..120	CDD:290568	19/52 (37%)
		ANK repeat	81..112	CDD:293786	13/30 (43%)
		Ank_5	100..154	CDD:290568	17/53 (32%)
		ANK repeat	114..144	CDD:293786	10/29 (34%)
		ANK repeat	147..180	CDD:293786	3/13 (23%)
asb1	NP_001002736.1	ANK repeat	35..69	CDD:293786	6/19 (32%)
		Ank_4	36..97	CDD:290365	10/47 (21%)
		ANK	38..163	CDD:238125	32/114 (28%)
		ANK repeat	78..107	CDD:293786	6/29 (21%)
		Ank_2	81..171	CDD:289560	30/90 (33%)
		ANK repeat	109..140	CDD:293786	13/30 (43%)
		ANK repeat	142..171	CDD:293786	10/28 (36%)
		ANK repeat	185..217	CDD:293786	1/3 (33%)
		ANK repeat	232..264	CDD:293786
		SOCS	292..333	CDD:295349
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910