| Sequence 1: | NP_609735.1 | Gene: | l(2)35Be / 34874 | FlyBaseID: | FBgn0261881 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017753.1 | Gene: | asb5b / 550449 | ZFINID: | ZDB-GENE-050417-271 | Length: | 328 | Species: | Danio rerio |
| Alignment Length: | 196 | Identity: | 50/196 - (25%) |
|---|---|---|---|
| Similarity: | 75/196 - (38%) | Gaps: | 53/196 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 55 AVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPL 119
Fly 120 HSACKWNNADCAHLLLQ--------------------------------FGADVNAESDGKQTPL 152
Fly 153 HITATVSNCRNTATVLL-----------LDRYIQPRKENNSEEL--------ASVIARRTGMSFP 198
Fly 199 I 199 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(2)35Be | NP_609735.1 | ANK repeat | 52..79 | CDD:293786 | 4/23 (17%) |
| ANK | 54..169 | CDD:238125 | 39/145 (27%) | ||
| Ank_5 | 67..120 | CDD:290568 | 19/52 (37%) | ||
| ANK repeat | 81..112 | CDD:293786 | 13/30 (43%) | ||
| Ank_5 | 100..154 | CDD:290568 | 23/85 (27%) | ||
| ANK repeat | 114..144 | CDD:293786 | 14/61 (23%) | ||
| ANK repeat | 147..180 | CDD:293786 | 11/43 (26%) | ||
| asb5b | NP_001017753.1 | ANK | 70..187 | CDD:238125 | 28/111 (25%) |
| ANK repeat | 70..99 | CDD:293786 | 4/23 (17%) | ||
| Ank_2 | 73..161 | CDD:289560 | 28/85 (33%) | ||
| ANK repeat | 101..132 | CDD:293786 | 13/30 (43%) | ||
| ANK repeat | 134..162 | CDD:293786 | 10/27 (37%) | ||
| ANK | 169..284 | CDD:238125 | 22/102 (22%) | ||
| ANK repeat | 169..197 | CDD:293786 | 4/27 (15%) | ||
| Ank_2 | 171..262 | CDD:289560 | 20/91 (22%) | ||
| ANK repeat | 199..229 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 231..262 | CDD:293786 | 7/30 (23%) | ||
| ANK repeat | 264..302 | CDD:293786 | 1/6 (17%) | ||
| SOCS_ASB5 | 287..328 | CDD:239694 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1546307at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||