DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and ankrd49

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001017584.2 Gene:ankrd49 / 550246 ZFINID:ZDB-GENE-050417-46 Length:218 Species:Danio rerio


Alignment Length:210 Identity:80/210 - (38%)
Similarity:118/210 - (56%) Gaps:15/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DSDDEKSQVEKLRHAKVPRGMFVSGWDDDADELIEEDK-------------NPQSSIERMILWAV 56
            |..::.:|:|.|....:|.|. .|.|.:: :|..|||:             :.|.:...::|||.
Zfish     2 DFPEDFNQLELLDPHVIPMGT-RSNWAEE-EEGEEEDEAMHTEEWHQQQELHLQDTPSELMLWAA 64

  Fly    57 NENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHS 121
            ..||.:.|..::.||...||..|:|||||||||||:...|:|..||:..||.:|||...|.||||
Zfish    65 ERNRCATVERLIALDPTLVNCHDSDGYTPLHRAAYSGHHDVASALLKAGANLHARTADDWMPLHS 129

  Fly   122 ACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELA 186
            ||:|.:|:.|.||||:|::|||.:.|:.|||.:.|..:....|..:||..|.::...:|::.|.|
Zfish   130 ACRWGHANVASLLLQWGSEVNAMTAGRLTPLQLAAGNAAAGKTIELLLSQRTLEAGLKNSAGETA 194

  Fly   187 SVIARRTGMSFPIFE 201
            ..||.||.....:||
Zfish   195 YDIAHRTSELHRLFE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 10/26 (38%)
ANK 54..169 CDD:238125 54/114 (47%)
Ank_5 67..120 CDD:290568 27/52 (52%)
ANK repeat 81..112 CDD:293786 18/30 (60%)
Ank_5 100..154 CDD:290568 29/53 (55%)
ANK repeat 114..144 CDD:293786 17/29 (59%)
ANK repeat 147..180 CDD:293786 9/32 (28%)
ankrd49NP_001017584.2 ANK 62..166 CDD:238125 53/103 (51%)
Ank_2 62..151 CDD:289560 46/88 (52%)
ANK repeat 89..120 CDD:293786 18/30 (60%)
ANK repeat 122..151 CDD:293786 16/28 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0512
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9787
Inparanoid 1 1.050 133 1.000 Inparanoid score I4588
OMA 1 1.010 - - QHG48821
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 1 1.000 - - FOG0007458
OrthoInspector 1 1.000 - - oto38614
orthoMCL 1 0.900 - - OOG6_107702
Panther 1 1.100 - - LDO PTHR24144
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4168
SonicParanoid 1 1.000 - - X5588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.