DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and asb9

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001005055.2 Gene:asb9 / 448606 XenbaseID:XB-GENE-947922 Length:287 Species:Xenopus tropicalis


Alignment Length:205 Identity:55/205 - (26%)
Similarity:75/205 - (36%) Gaps:75/205 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FVSGWDDDAD-----ELIEEDK--NPQSSIERMILWAVNENRISEVRE------------ILKLD 71
            |||.|....|     .|:..:|  |...|:.:|     ..:|:|.:.|            :||..
 Frog    26 FVSDWSPIHDASLHGRLLALNKLINQGYSVNQM-----TADRMSPLHEACLGGHPACVSLLLKHG 85

  Fly    72 ADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCA----- 131
            |. ||..|.|..||:..|..:..||...||||..|:|:...|:. :|:|.|||..:..|.     
 Frog    86 AQ-VNTLDIDWKTPIFNACISGNVDCVNLLLQNGASPHPACEVA-SPIHEACKRGHTACVETLSS 148

  Fly   132 ----------HL------------------LLQFGADVNAESDGKQTPLHITATVSN-------- 160
                      ||                  ||:|||:.|...| .::|||..|...|        
 Frog   149 AGVSVQQYIKHLGSPLYVACENQRVDTAKKLLEFGANANVGKD-LESPLHAAARTGNSDLVKLLI 212

  Fly   161 -------CRN 163
                   |||
 Frog   213 DYDGSAQCRN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 8/38 (21%)
ANK 54..169 CDD:238125 45/170 (26%)
Ank_5 67..120 CDD:290568 20/52 (38%)
ANK repeat 81..112 CDD:293786 12/30 (40%)
Ank_5 100..154 CDD:290568 24/86 (28%)
ANK repeat 114..144 CDD:293786 14/62 (23%)
ANK repeat 147..180 CDD:293786 8/32 (25%)
asb9NP_001005055.2 ANK repeat 28..59 CDD:293786 8/35 (23%)
Ank_2 33..122 CDD:289560 26/94 (28%)
ANK 56..180 CDD:238125 31/130 (24%)
ANK repeat 61..92 CDD:293786 8/31 (26%)
ANK repeat 94..122 CDD:293786 11/27 (41%)
ANK repeat 129..157 CDD:293786 6/27 (22%)
Ank_2 131..222 CDD:289560 20/91 (22%)
ANK repeat 159..189 CDD:293786 8/29 (28%)
ANK 190..>228 CDD:295348 9/34 (26%)
ANK repeat 191..222 CDD:293786 7/31 (23%)
SOCS 246..287 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.