DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and Asb9

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001178842.1 Gene:Asb9 / 367785 RGDID:1560537 Length:290 Species:Rattus norvegicus


Alignment Length:196 Identity:52/196 - (26%)
Similarity:72/196 - (36%) Gaps:54/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GMFVSGWDDDADELIEEDKNPQSSIERMIL--WAVN---ENRISEVRE-----------ILKLDA 72
            |..||.|....|..|.   ....::..:|.  |.||   .:.:|.:.|           :|....
  Rat    27 GDVVSDWSPLHDAAIH---GRLLTLRNLISQGWPVNIITADHVSPLHEACLRGHLSCATVLISHG 88

  Fly    73 DTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELG---------------------- 115
            ..||....|..|||..|..:...|...||||:.|.|:..::|.                      
  Rat    89 AQVNGMTIDWRTPLFNACVSGSQDCVNLLLQHGAAPHPESDLASPIHEAAKRGHAKCIESLAAHG 153

  Fly   116 ----------WTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLL 170
                      .|||:.|||....|||..||:.||.|| :..|..:|||:.|.:|:  .....||:
  Rat   154 ANIDYNISHLGTPLYVACKNQQVDCAKKLLESGASVN-QGKGSDSPLHVVARMSS--GELVHLLM 215

  Fly   171 D 171
            |
  Rat   216 D 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 9/42 (21%)
ANK 54..169 CDD:238125 42/160 (26%)
Ank_5 67..120 CDD:290568 18/84 (21%)
ANK repeat 81..112 CDD:293786 12/30 (40%)
Ank_5 100..154 CDD:290568 25/85 (29%)
ANK repeat 114..144 CDD:293786 16/61 (26%)
ANK repeat 147..180 CDD:293786 9/25 (36%)
Asb9NP_001178842.1 PLN03192 <27..214 CDD:215625 49/192 (26%)
ANK repeat 31..62 CDD:293786 8/33 (24%)
Ank_2 36..122 CDD:403870 21/88 (24%)
ANK repeat 64..95 CDD:293786 5/30 (17%)
ANK repeat 97..127 CDD:293786 12/29 (41%)
ANK repeat 132..160 CDD:293786 0/27 (0%)
ANK repeat 162..192 CDD:293786 15/30 (50%)
ANK repeat 194..225 CDD:293786 9/25 (36%)
SOCS 249..290 CDD:413360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.