DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and Asb5

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	XP_017455679.1	Gene:	Asb5 / 361187	RGDID:	1565973	Length:	329	Species:	Rattus norvegicus

Alignment Length:	111	Identity:	43/111 - (38%)
Similarity:	58/111 - (52%)	Gaps:	4/111 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    55 AVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPL 119
            |.::.|:..:|.:|. ....|||...|..||||.|...:.|..|:.||:..||.||.|..|.|||
  Rat    77 AASQGRLLALRTLLS-QGYNVNAVTIDHVTPLHEACLGDHVACARTLLEAGANANAITIDGVTPL 140

  Fly   120 HSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSN--CRN 163
            .:||...:|.||.|||::||....|| ...:|.|..|:..:  |.|
  Rat   141 FNACSQGSASCAELLLEYGAKAQLES-CFPSPTHEAASKGHHECLN 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	7/23 (30%)
		ANK	54..169	CDD:238125	43/111 (39%)
		Ank_5	67..120	CDD:290568	22/52 (42%)
		ANK repeat	81..112	CDD:293786	14/30 (47%)
		Ank_5	100..154	CDD:290568	24/53 (45%)
		ANK repeat	114..144	CDD:293786	14/29 (48%)
		ANK repeat	147..180	CDD:293786	5/19 (26%)
Asb5	XP_017455679.1	ANK repeat	71..100	CDD:293786	7/23 (30%)
		PHA02876	<72..>288	CDD:165207	43/111 (39%)
		ANK repeat	102..133	CDD:293786	14/30 (47%)
		ANK repeat	135..160	CDD:293786	12/24 (50%)
		ANK repeat	170..198	CDD:293786	5/16 (31%)
		ANK repeat	200..230	CDD:293786
		ANK repeat	232..263	CDD:293786
		SOCS_ASB5	288..329	CDD:239694
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1546307at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010