| Sequence 1: | NP_609735.1 | Gene: | l(2)35Be / 34874 | FlyBaseID: | FBgn0261881 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038946794.1 | Gene: | Rnasel / 359726 | RGDID: | 727933 | Length: | 743 | Species: | Rattus norvegicus |
| Alignment Length: | 235 | Identity: | 55/235 - (23%) |
|---|---|---|---|
| Similarity: | 90/235 - (38%) | Gaps: | 74/235 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 MILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELG 115
Fly 116 WTP---------------------------LH------SACKWNNADCAHLLLQFGADVNAESDG 147
Fly 148 KQTPLHI-----TATVSNCRN---TATVLLLD------------------RYIQPRK----ENNS 182
Fly 183 EELASVI--------ARRTGMSFPIFESGEEAYDCETGLI 214 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(2)35Be | NP_609735.1 | ANK repeat | 52..79 | CDD:293786 | 7/26 (27%) |
| ANK | 54..169 | CDD:238125 | 38/155 (25%) | ||
| Ank_5 | 67..120 | CDD:290568 | 21/79 (27%) | ||
| ANK repeat | 81..112 | CDD:293786 | 14/30 (47%) | ||
| Ank_5 | 100..154 | CDD:290568 | 19/86 (22%) | ||
| ANK repeat | 114..144 | CDD:293786 | 12/62 (19%) | ||
| ANK repeat | 147..180 | CDD:293786 | 9/62 (15%) | ||
| Rnasel | XP_038946794.1 | PHA02875 | 29..>188 | CDD:165206 | 38/158 (24%) |
| ANK repeat | 29..55 | CDD:293786 | 7/25 (28%) | ||
| ANK repeat | 59..89 | CDD:293786 | 14/29 (48%) | ||
| ANK repeat | 91..122 | CDD:293786 | 3/30 (10%) | ||
| ANK repeat | 124..153 | CDD:293786 | 8/28 (29%) | ||
| ANK repeat | 167..199 | CDD:293786 | 7/31 (23%) | ||
| Ank_4 | 170..216 | CDD:372654 | 9/45 (20%) | ||
| ANK repeat | 201..239 | CDD:293786 | 7/37 (19%) | ||
| Ank_2 | 224..302 | CDD:403870 | 10/39 (26%) | ||
| ANK repeat | 242..274 | CDD:293786 | 6/21 (29%) | ||
| PTZ00322 | 259..>369 | CDD:140343 | 0/1 (0%) | ||
| ANK repeat | 276..301 | CDD:293786 | |||
| PKc_like | 379..590 | CDD:419665 | |||
| RNase_RNase-L | 599..715 | CDD:199218 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||