DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and Patsas

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster


Alignment Length:148 Identity:45/148 - (30%)
Similarity:73/148 - (49%) Gaps:9/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SGWDDDADELIEEDKNPQSSIERMILWAVNEN-RISEVREIL-KLDADTVNAKDNDGYTPLHRAA 90
            ||.:|..:.|:.|..:..:::....::.:.:| .:|||..:: |...:.::|:|..||||.|..|
  Fly    93 SGVEDHENVLLFEGLDGATTVSLDDIFDIIKNGEVSEVENLVDKFGMECLSARDRHGYTPAHWIA 157

  Fly    91 YNNFVDMAKLLLQYHAN---PNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPL 152
            .|..|.:.:.|::..|.   |...|: |..|:|.||:..:|....:|||.|..|||......|||
  Fly   158 LNGNVQLMRYLIERTAPIDLPCLGTQ-GPRPIHWACRKGHASVVQVLLQAGVAVNAADFKGLTPL 221

  Fly   153 HITATVSNCRNTATVLLL 170
            |:.....   .|||...|
  Fly   222 HLACMYG---RTATAAYL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 6/28 (21%)
ANK 54..169 CDD:238125 39/119 (33%)
Ank_5 67..120 CDD:290568 17/56 (30%)
ANK repeat 81..112 CDD:293786 11/33 (33%)
Ank_5 100..154 CDD:290568 20/56 (36%)
ANK repeat 114..144 CDD:293786 12/29 (41%)
ANK repeat 147..180 CDD:293786 8/24 (33%)
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738 40/128 (31%)
ANK repeat 148..181 CDD:293786 11/32 (34%)
ANK repeat 187..214 CDD:293786 12/26 (46%)
ANK repeat 216..247 CDD:293786 8/24 (33%)
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.