DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and nompC

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster


Alignment Length:215 Identity:52/215 - (24%)
Similarity:80/215 - (37%) Gaps:78/215 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSGWDDDADEL--------IEEDKNPQSSIERMILWA------------------VNENRI---- 61
            |:|.:|...|:        |::..|.|||:.    |.                  .|..|:    
  Fly   630 VAGNNDVLMEMISHMNPTDIQKAMNRQSSVG----WTPLLIACHRGHMELVNNLLANHARVDVFD 690

  Fly    62 SEVREILKLDADT---------------VNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNAR 111
            :|.|..|.|.|:.               :|:|...|.|.||.||.|.|..:.|.|::.|   ||.
  Fly   691 TEGRSALHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDH---NAV 752

  Fly   112 TEL----GWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDR 172
            .::    ..||||.|......:...|||:.||:::|..|..|.|:|:.|                
  Fly   753 IDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAA---------------- 801

  Fly   173 YIQPRKENNSEELASVIARR 192
                  :||..|:|.:..::
  Fly   802 ------QNNYSEVAKLFLQQ 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 9/63 (14%)
ANK 54..169 CDD:238125 39/155 (25%)
Ank_5 67..120 CDD:290568 20/71 (28%)
ANK repeat 81..112 CDD:293786 13/30 (43%)
Ank_5 100..154 CDD:290568 18/57 (32%)
ANK repeat 114..144 CDD:293786 10/33 (30%)
ANK repeat 147..180 CDD:293786 4/32 (13%)
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125 4/10 (40%)
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560 18/95 (19%)
ANK 654..780 CDD:238125 33/132 (25%)
ANK repeat 660..690 CDD:293786 3/33 (9%)
ANK repeat 692..723 CDD:293786 6/30 (20%)
Ank_2 697..790 CDD:289560 29/95 (31%)
ANK 720..847 CDD:238125 35/121 (29%)
ANK repeat 725..757 CDD:293786 13/34 (38%)
ANK repeat 759..790 CDD:293786 11/30 (37%)
Ank_5 779..834 CDD:290568 14/59 (24%)
ANK 787..915 CDD:238125 10/51 (20%)
ANK repeat 792..824 CDD:293786 8/46 (17%)
ANK repeat 861..893 CDD:293786
Ank_4 865..915 CDD:290365
Ank_4 929..995 CDD:290365
ANK repeat 932..972 CDD:293786
ANK 969..1096 CDD:238125
ANK repeat 974..1007 CDD:293786
Ank_2 979..1074 CDD:289560
ANK repeat 1009..1041 CDD:293786
ANK 1039..1159 CDD:238125
ANK repeat 1043..1074 CDD:293786
Ank_2 1048..1135 CDD:289560
ANK repeat 1076..1101 CDD:293786
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.