DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and ankmy2a

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_956188.1	Gene:	ankmy2a / 334389	ZFINID:	ZDB-GENE-030131-6321	Length:	420	Species:	Danio rerio

Alignment Length:	144	Identity:	42/144 - (29%)
Similarity:	63/144 - (43%)	Gaps:	9/144 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 KNPQSSIERMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHA 106
            |...:..|:.:|..:....:.|...:|......||..|..|.|||..|||....||.|||||:.|
Zfish     6 KGDLTDTEKELLQVIAAGNVQEASRLLGSKDVKVNCLDEYGMTPLMHAAYKGKADMCKLLLQHGA 70

  Fly   107 NPNART-ELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVL-- 168
            :.|... |.|:|.|..|......:...::|..||:.:|.:...:|...:.|.|.. .:..||:
Zfish    71 DVNCNEHEHGYTALMFAGLSGKTEITWMMLDAGAETDAVNSVGRTAAQMAAFVGQ-HDCVTVINN 134

  Fly   169 -----LLDRYIQPR 177
                 .||.|.:|:
Zfish   135 FFSRARLDYYTKPQ 148

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	5/26 (19%)
		ANK	54..169	CDD:238125	35/122 (29%)
		Ank_5	67..120	CDD:290568	23/53 (43%)
		ANK repeat	81..112	CDD:293786	16/30 (53%)
		Ank_5	100..154	CDD:290568	16/54 (30%)
		ANK repeat	114..144	CDD:293786	7/29 (24%)
		ANK repeat	147..180	CDD:293786	9/38 (24%)
ankmy2a	NP_956188.1	ANK	16..132	CDD:238125	35/116 (30%)
		Ank_2	16..110	CDD:289560	31/93 (33%)
		ANK repeat	16..43	CDD:293786	5/26 (19%)
		ANK repeat	45..76	CDD:293786	16/30 (53%)
		ANK repeat	79..110	CDD:293786	8/30 (27%)
		zf-MYND	320..357	CDD:280009
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910