DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and Asb11

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_006256920.2 Gene:Asb11 / 302666 RGDID:1566298 Length:323 Species:Rattus norvegicus


Alignment Length:182 Identity:44/182 - (24%)
Similarity:67/182 - (36%) Gaps:68/182 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSGWDDDADELIEE----------DKNPQS---------SIERMILWAVNENRISEVREILKLDA 72
            |.|...:|..:.||          |::|..         :::.:|...:|.|.:           
  Rat    41 VKGNRKEAARIAEEIYGGLSDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLV----------- 94

  Fly    73 DTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQF 137
             |:|.     .:.||.|.....|..||.||:..|:.|..|..|.|||.:||...:|.|.::||:|
  Rat    95 -TINR-----VSSLHEACLGGHVACAKALLENGAHVNGLTVHGATPLFNACCSGSAACVNVLLEF 153

  Fly   138 GA------------------------------DVNAESDGKQ--TPLHITAT 157
            ||                              :||.|.:..|  |||::..|
  Rat   154 GAKAQLEVYLASPIHEAVKRGHRECMEILLANNVNIEQEIPQLGTPLYVACT 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 5/26 (19%)
ANK 54..169 CDD:238125 36/136 (26%)
Ank_5 67..120 CDD:290568 16/52 (31%)
ANK repeat 81..112 CDD:293786 10/30 (33%)
Ank_5 100..154 CDD:290568 25/85 (29%)
ANK repeat 114..144 CDD:293786 15/59 (25%)
ANK repeat 147..180 CDD:293786 5/13 (38%)
Asb11XP_006256920.2 Ank_2 39..>284 CDD:423045 44/182 (24%)
ANK repeat 66..95 CDD:293786 4/40 (10%)
ANK repeat 97..128 CDD:293786 11/35 (31%)
ANK repeat 130..155 CDD:293786 11/24 (46%)
ANK repeat 165..193 CDD:293786 3/27 (11%)
ANK repeat 195..225 CDD:293786 5/11 (45%)
ANK repeat 227..258 CDD:293786
SOCS 282..323 CDD:413360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.