DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and Ankrd44

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_017451840.1 Gene:Ankrd44 / 301415 RGDID:1561893 Length:1074 Species:Rattus norvegicus


Alignment Length:206 Identity:55/206 - (26%)
Similarity:78/206 - (37%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLL------------ 102
            |.:.||.....:..|..::...|: |..||..||||||.||.|..:::.|.||            
  Rat   175 RALHWAAYMGHLDVVALLINHGAE-VTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVY 238

  Fly   103 ---------------------QYHANPNARTELGWTPLH-SACKWNNADCAHLLLQFGADVNAES 145
                                 .|.||.|.....|:|||| :|...:.|.|..||:..|||||.:|
  Rat   239 GNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQS 303

  Fly   146 DGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELASV---------IARRTGMSF---P 198
            ...::|||:||.......:.|::           .|..|:..|         :|.|.|...   .
  Rat   304 KDGKSPLHMTAVHGRFTRSQTLI-----------QNGGEIDCVDKDGNTPLHVAARYGHELLINT 357

  Fly   199 IFESGEEAYDC 209
            :..||.:...|
  Rat   358 LITSGADTAKC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 5/26 (19%)
ANK 54..169 CDD:238125 45/148 (30%)
Ank_5 67..120 CDD:290568 23/85 (27%)
ANK repeat 81..112 CDD:293786 16/63 (25%)
Ank_5 100..154 CDD:290568 24/87 (28%)
ANK repeat 114..144 CDD:293786 15/30 (50%)
ANK repeat 147..180 CDD:293786 6/32 (19%)
Ankrd44XP_017451840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.