| Sequence 1: | NP_609735.1 | Gene: | l(2)35Be / 34874 | FlyBaseID: | FBgn0261881 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_056151.2 | Gene: | ZDHHC17 / 23390 | HGNCID: | 18412 | Length: | 632 | Species: | Homo sapiens |
| Alignment Length: | 199 | Identity: | 50/199 - (25%) |
|---|---|---|---|
| Similarity: | 80/199 - (40%) | Gaps: | 30/199 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 SGWD----------DDADELIE---EDKNPQSSIERMILWAVNENRISEVREILKLDA--DTVNA 77
Fly 78 KDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVN 142
Fly 143 AESDGKQTPL----HITATVSNCRNTAT----VLLLDRYIQPRKENNSEELASVIARRTGMSFPI 199
Fly 200 FESG 203 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(2)35Be | NP_609735.1 | ANK repeat | 52..79 | CDD:293786 | 8/28 (29%) |
| ANK | 54..169 | CDD:238125 | 34/124 (27%) | ||
| Ank_5 | 67..120 | CDD:290568 | 14/54 (26%) | ||
| ANK repeat | 81..112 | CDD:293786 | 10/30 (33%) | ||
| Ank_5 | 100..154 | CDD:290568 | 14/57 (25%) | ||
| ANK repeat | 114..144 | CDD:293786 | 7/29 (24%) | ||
| ANK repeat | 147..180 | CDD:293786 | 11/40 (28%) | ||
| ZDHHC17 | NP_056151.2 | Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 | 11..305 | 50/199 (25%) | |
| ANK repeat | 89..120 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 94..187 | CDD:403870 | 26/94 (28%) | ||
| ANK repeat | 122..154 | CDD:293786 | 11/33 (33%) | ||
| ANK repeat | 156..187 | CDD:293786 | 7/30 (23%) | ||
| Ank_2 | 161..255 | CDD:403870 | 23/93 (25%) | ||
| ANK repeat | 189..221 | CDD:293786 | 9/31 (29%) | ||
| ANK repeat | 224..255 | CDD:293786 | 6/25 (24%) | ||
| Ank_2 | 229..>286 | CDD:423045 | 5/20 (25%) | ||
| DHHC | 438..568 | CDD:396215 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||