DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and daf-25

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_490719.1 Gene:daf-25 / 171623 WormBaseID:WBGene00000917 Length:388 Species:Caenorhabditis elegans


Alignment Length:163 Identity:36/163 - (22%)
Similarity:68/163 - (41%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EEDKNPQSSIERMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQ 103
            |..|:|       :..|:::|.......:||....... :|..|.:.|..|||...:.:.:..::
 Worm     6 EAPKSP-------LFEAIDKNDTEAALALLKTKEQAAQ-RDPSGMSVLAAAAYRGNLTLVEKAIE 62

  Fly   104 YHANPNARTELG--WTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSN--C--- 161
            ...:.|.:|: |  :|||..|......|...||:..||.:...:...:|...:.|.|.:  |   
 Worm    63 LKCDVNDKTD-GTLYTPLMFAALSGKQDVCRLLMDSGARMYLVNGIGKTASELAAFVGHHECVAI 126

  Fly   162 -RNTATVLLLDRYIQPR---KENNSEELASVIA 190
             .|..|:.:::..::|:   |...:||....:|
 Worm   127 INNHITIDVIEDLLRPKVNGKYEGAEEYPDELA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 4/26 (15%)
ANK 54..169 CDD:238125 28/122 (23%)
Ank_5 67..120 CDD:290568 13/54 (24%)
ANK repeat 81..112 CDD:293786 6/30 (20%)
Ank_5 100..154 CDD:290568 13/55 (24%)
ANK repeat 114..144 CDD:293786 10/31 (32%)
ANK repeat 147..180 CDD:293786 8/41 (20%)
daf-25NP_490719.1 ANK 9..127 CDD:238125 28/126 (22%)
ANK repeat 10..38 CDD:293786 5/35 (14%)
Ank_2 12..105 CDD:289560 22/94 (23%)
ANK repeat 40..72 CDD:293786 6/31 (19%)
ANK repeat 74..105 CDD:293786 9/30 (30%)
Ank_2 79..>134 CDD:289560 13/54 (24%)
zf-MYND 321..357 CDD:280009
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.