DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and ASB9

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_016884772.1 Gene:ASB9 / 140462 HGNCID:17184 Length:377 Species:Homo sapiens


Alignment Length:132 Identity:44/132 - (33%)
Similarity:58/132 - (43%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSGWDDDADELIEEDKNPQSSIERMIL--WAVNENRISEVREILKLDADTVNAKDNDGYTPLHRA 89
            ||.|....:..|.   ..|.|:..:|.  ||||           .:.||.|        :|||.|
Human   117 VSDWSPMHEAAIH---GHQLSLRNLISQGWAVN-----------IITADHV--------SPLHEA 159

  Fly    90 AYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHI 154
            .....:...|:||::.|..|..|....|||.:||...:.||.:||||.||.|..||| ..:|:|.
Human   160 CLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESD-LASPIHE 223

  Fly   155 TA 156
            .|
Human   224 AA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 8/28 (29%)
ANK 54..169 CDD:238125 37/103 (36%)
Ank_5 67..120 CDD:290568 15/52 (29%)
ANK repeat 81..112 CDD:293786 9/30 (30%)
Ank_5 100..154 CDD:290568 23/53 (43%)
ANK repeat 114..144 CDD:293786 14/29 (48%)
ANK repeat 147..180 CDD:293786 3/10 (30%)
ASB9XP_016884772.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.