DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and ASZ1

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_570124.1 Gene:ASZ1 / 136991 HGNCID:1350 Length:475 Species:Homo sapiens


Alignment Length:203 Identity:50/203 - (24%)
Similarity:78/203 - (38%) Gaps:58/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AKVPRGMFVSGW------DDDADELIEEDKNPQSSIERMILWAVNENRISEVREILKLDADTVNA 77
            |...||:.|:|.      :||..|:...|:..| .::|::       .|.|.:|..|        
Human     3 ASALRGLPVAGGGESSESEDDGWEIGYLDRTSQ-KLKRLL-------PIEEKKEKFK-------- 51

  Fly    78 KDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVN 142
                      :|.....|.:.:.||....:.::..:.|||||..|....||:...:||..||:.:
Human    52 ----------KAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANAS 106

  Fly   143 AESDGKQTPLHITA--------TVSNCRNTATVLLLDRYIQPRKENNSEELASVIARRTGMSFPI 199
            .|.| ||:.| |||        .:..|    ..|||.|...|          :|..||  :..||
Human   107 FEKD-KQSIL-ITACSAHGSEEQILKC----VELLLSRNADP----------NVACRR--LMTPI 153

  Fly   200 FESGEEAY 207
            ..:..:.:
Human   154 MYAARDGH 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 4/26 (15%)
ANK 54..169 CDD:238125 29/122 (24%)
Ank_5 67..120 CDD:290568 9/52 (17%)
ANK repeat 81..112 CDD:293786 4/30 (13%)
Ank_5 100..154 CDD:290568 19/53 (36%)
ANK repeat 114..144 CDD:293786 12/29 (41%)
ANK repeat 147..180 CDD:293786 12/40 (30%)
ASZ1NP_570124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 7/21 (33%)
ANK 1. /evidence=ECO:0000305 45..74 7/46 (15%)
ANK 78..202 CDD:238125 31/102 (30%)
ANK repeat 78..109 CDD:293786 12/30 (40%)
ANK 2. /evidence=ECO:0000305 78..107 12/28 (43%)
ANK repeat 110..146 CDD:293786 14/51 (27%)
ANK 3. /evidence=ECO:0000305 110..144 13/49 (27%)
ANK repeat 148..179 CDD:293786 3/16 (19%)
ANK 4. /evidence=ECO:0000305 148..177 3/16 (19%)
ANK 176..>234 CDD:238125
ANK 5. /evidence=ECO:0000305 181..210
ANK repeat 181..206 CDD:293786
ANK 6. /evidence=ECO:0000305 214..243
SAM_ASZ1 272..334 CDD:188920
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.