DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and AgaP_AGAP008928

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_319681.2 Gene:AgaP_AGAP008928 / 1279899 VectorBaseID:AGAP008928 Length:564 Species:Anopheles gambiae


Alignment Length:169 Identity:52/169 - (30%)
Similarity:81/169 - (47%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DEKSQVEKLRHAKVPRGMFVSGWDDDADELIEEDKNP---QSSIERMILWAVNENRISEVREIL- 68
            :|.........||.|.      .:.|::.|...|.:.   |||::. |...:....:|||..:: 
Mosquito    29 EESDHPHHPEEAKTPT------QEKDSNLLARTDSSEVLIQSSMDD-IFDVIKSGELSEVENLVE 86

  Fly    69 KLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHAN---PNARTELGWTPLHSACKWNNADC 130
            |:..:.::|:|..||||.|.||.:..|:|.:.|::.:|.   |...|: |..|:|.||:..:|..
Mosquito    87 KVGQEALSARDKHGYTPAHWAALDGNVEMMRYLVERNAPVDLPCLGTQ-GPRPIHWACRKGHAAV 150

  Fly   131 AHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLL 169
            ..:|||.|..|||......||| :||.:.....||..||
Mosquito   151 VQVLLQAGVAVNAADFKGLTPL-MTACMYGRTATAAYLL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 6/27 (22%)
ANK 54..169 CDD:238125 39/118 (33%)
Ank_5 67..120 CDD:290568 18/56 (32%)
ANK repeat 81..112 CDD:293786 12/33 (36%)
Ank_5 100..154 CDD:290568 20/56 (36%)
ANK repeat 114..144 CDD:293786 12/29 (41%)
ANK repeat 147..180 CDD:293786 9/23 (39%)
AgaP_AGAP008928XP_319681.2 ANKYR 64..288 CDD:223738 44/128 (34%)
ANK repeat 99..132 CDD:293786 12/32 (38%)
ANK 99..128 CDD:197603 11/28 (39%)
ANK 138..253 CDD:238125 21/52 (40%)
ANK repeat 138..165 CDD:293786 12/26 (46%)
ANK repeat 167..198 CDD:293786 9/23 (39%)
ANK repeat 200..231 CDD:293786
zf-DHHC 321..544 CDD:303066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.