DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and AgaP_AGAP007813

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_317687.3 Gene:AgaP_AGAP007813 / 1278145 VectorBaseID:AGAP007813 Length:235 Species:Anopheles gambiae


Alignment Length:218 Identity:120/218 - (55%)
Similarity:154/218 - (70%) Gaps:6/218 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYDSDDEKSQVEKL-----RHAKVPRGMFVSGWDDDADELIEEDKNPQSSIERMILWAVNENRIS 62
            |..:::|:.:::.|     :.:||||||||||| ||.|:||||||.|.:|.||.:|||..||:..
Mosquito    19 DDAAEEEEEEMDTLEALEAKMSKVPRGMFVSGW-DDPDDLIEEDKEPNASYERQVLWAAGENKQE 82

  Fly    63 EVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNN 127
            .|..|:......|.|.|.||||.||:|.|||..:||.:||:|.::|||||::|||||||||||||
Mosquito    83 IVEAIVCRKPCVVEAIDRDGYTALHKACYNNNREMAMVLLRYGSDPNARTDMGWTPLHSACKWNN 147

  Fly   128 ADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELASVIARR 192
            |.||.||||.||||||.|||.|||||||.|||:||:|...||::....|.:.|||:|.|..||:|
Mosquito   148 AGCAALLLQHGADVNAPSDGDQTPLHITVTVSSCRSTLVTLLMNGRCDPERRNNSDEKAEQIAKR 212

  Fly   193 TGMSFPIFESGEEAYDCETGLID 215
            :|.:||:|.....|:..|||:||
Mosquito   213 SGDTFPLFAMAHSAFTVETGMID 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 9/26 (35%)
ANK 54..169 CDD:238125 71/114 (62%)
Ank_5 67..120 CDD:290568 28/52 (54%)
ANK repeat 81..112 CDD:293786 18/30 (60%)
Ank_5 100..154 CDD:290568 41/53 (77%)
ANK repeat 114..144 CDD:293786 25/29 (86%)
ANK repeat 147..180 CDD:293786 17/32 (53%)
AgaP_AGAP007813XP_317687.3 Ank_2 57..131 CDD:289560 37/73 (51%)
ANK 74..190 CDD:238125 72/115 (63%)
ANK repeat 101..132 CDD:293786 18/30 (60%)
Ank_2 106..200 CDD:289560 61/93 (66%)
ANK repeat 134..165 CDD:293786 26/30 (87%)
ANK repeat 167..200 CDD:293786 17/32 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I15444
eggNOG 1 0.900 - - E2759_KOG0512
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9787
Inparanoid 1 1.050 242 1.000 Inparanoid score I5684
OMA 1 1.010 - - QHG48821
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 1 1.000 - - FOG0007458
OrthoInspector 1 1.000 - - oto108873
Panther 1 1.100 - - LDO PTHR24144
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5588
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.