DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and AgaP_AGAP012913

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	XP_306335.4	Gene:	AgaP_AGAP012913 / 1267778	VectorBaseID:	AGAP012913	Length:	282	Species:	Anopheles gambiae

Alignment Length:	116	Identity:	36/116 - (31%)
Similarity:	49/116 - (42%)	Gaps:	7/116 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 ILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGW 116
            :|||........||.::......||..|..|.|||..|......::..:||:..||.:......|
Mosquito   106 LLWASGRGHTEIVRLLVNTGGAKVNVGDKYGTTPLVWACRKGSAEIVDVLLKAGANVDTAGMYSW 170

  Fly   117 TPLHSACKWNNADCAHLLLQFGADVNA-ESDGKQTPLHITATVSNCRNTAT 166
            |||..|......:|..|||:...:||| :.||      :||....||...|
Mosquito   171 TPLLVAVSGGFQECVSLLLERKPNVNALDKDG------MTALSIACREGLT 215

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	7/26 (27%)
		ANK	54..169	CDD:238125	35/114 (31%)
		Ank_5	67..120	CDD:290568	15/52 (29%)
		ANK repeat	81..112	CDD:293786	9/30 (30%)
		Ank_5	100..154	CDD:290568	18/54 (33%)
		ANK repeat	114..144	CDD:293786	12/30 (40%)
		ANK repeat	147..180	CDD:293786	6/20 (30%)
AgaP_AGAP012913	XP_306335.4	ANK repeat	135..166	CDD:293786	9/30 (30%)
		Ank_2	140..232	CDD:289560	25/82 (30%)
		ANK repeat	168..199	CDD:293786	12/30 (40%)
		ANK repeat	201..232	CDD:293786	7/21 (33%)
		Ank_2	206..281	CDD:289560	3/10 (30%)
		ANK repeat	234..264	CDD:293786
		ANK repeat	2..33	CDD:293786
		Ank_2	7..97	CDD:289560
		ANK	31..156	CDD:238125	13/49 (27%)
		ANK repeat	35..66	CDD:293786
		ANK repeat	68..97	CDD:293786
		Ank_4	102..156	CDD:290365	13/49 (27%)
		ANK repeat	105..133	CDD:293786	7/26 (27%)
		ANK	130..255	CDD:238125	30/92 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910