DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and si:ch211-223a10.1

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_009305694.1 Gene:si:ch211-223a10.1 / 101884554 ZFINID:ZDB-GENE-090313-86 Length:544 Species:Danio rerio


Alignment Length:178 Identity:48/178 - (26%)
Similarity:69/178 - (38%) Gaps:35/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGW 116
            |..:|....|..|..:|:.|...:..|...|:|.||.||.|....:|:|||...|:||...:.|.
Zfish     9 IFESVQRGEIDRVSHLLQQDRGVLKQKGWGGFTALHFAALNGNRAVAELLLNSGADPNIPCDAGQ 73

  Fly   117 TPLHSACKWNNADCAHLLLQFGADVN-AESDGKQ------------------------------- 149
            ||.|.||:..|....:.::|.|||:. |:..||.                               
Zfish    74 TPFHFACRNGNIYIMYKMMQQGADLRIADEQGKTALHYAVSGGSVIATQYLWETRMFHFSDPDNY 138

  Fly   150 --TPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELASVIARRTGM 195
              ||||:.|:..| .:....||......|...::....|..:|...||
Zfish   139 QVTPLHLAASTGN-TDVVRYLLRANRCSPEAVDHQGATALHVAAEKGM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 6/26 (23%)
ANK 54..169 CDD:238125 40/148 (27%)
Ank_5 67..120 CDD:290568 20/52 (38%)
ANK repeat 81..112 CDD:293786 14/30 (47%)
Ank_5 100..154 CDD:290568 23/87 (26%)
ANK repeat 114..144 CDD:293786 11/30 (37%)
ANK repeat 147..180 CDD:293786 11/65 (17%)
si:ch211-223a10.1XP_009305694.1 ANK repeat 7..36 CDD:293786 6/26 (23%)
Ank_2 9..102 CDD:289560 32/92 (35%)
ANK 39..159 CDD:238125 34/120 (28%)
ANK repeat 39..69 CDD:293786 14/29 (48%)
ANK repeat 71..102 CDD:293786 11/30 (37%)
Ank_2 76..162 CDD:289560 19/86 (22%)
ANK repeat 138..170 CDD:293786 9/32 (28%)
Ank_4 139..192 CDD:290365 13/48 (27%)
zf-DHHC 384..509 CDD:279823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.