DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and invs

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	XP_002939636.1	Gene:	invs / 100487895	XenbaseID:	XB-GENE-1221137	Length:	1004	Species:	Xenopus tropicalis

Alignment Length:	134	Identity:	39/134 - (29%)
Similarity:	62/134 - (46%)	Gaps:	14/134 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 VNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGA 139
            |:..|.||.:|||.||.....::.::|::.:.||:|:...|.|||..|.......|..:|::..|
Frog   412 VHLVDKDGRSPLHWAALGGNANVCQILIENNINPDAQDYEGRTPLQCAAYGGYIGCMEVLMENKA 476

  Fly   140 DVNAESDGKQTPLHITATVSNCRN---TATVLLLDRYIQPRKENNSEELASVIARRTGMSFPIFE 201
            |.|.:....:|.||     .:|.|   .|..|||.....|.:..|:||      |.|.:.:.:..
Frog   477 DPNIQDKNGRTALH-----WSCNNGYLDAVKLLLGYSAFPNQMENTEE------RYTPLDYALLG 530

  Fly   202 SGEE 205
            ..:|
Frog   531 GHQE 534

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	1/3 (33%)
		ANK	54..169	CDD:238125	29/96 (30%)
		Ank_5	67..120	CDD:290568	16/44 (36%)
		ANK repeat	81..112	CDD:293786	11/30 (37%)
		Ank_5	100..154	CDD:290568	16/53 (30%)
		ANK repeat	114..144	CDD:293786	10/29 (34%)
		ANK repeat	147..180	CDD:293786	10/35 (29%)
invs	XP_002939636.1	ANKYR	<2..135	CDD:223738
		ANK repeat	12..41	CDD:293786
		ANK repeat	44..74	CDD:293786
		ANK repeat	76..142	CDD:293786
		ANK repeat	146..175	CDD:293786
		PHA03095	161..>456	CDD:222980	15/43 (35%)
		ANK repeat	177..214	CDD:293786
		ANK repeat	216..248	CDD:293786
		ANK repeat	250..282	CDD:293786
		ANK repeat	284..312	CDD:293786
		ANK repeat	317..344	CDD:293786
		ANK repeat	352..383	CDD:293786
		ANK repeat	385..416	CDD:293786	1/3 (33%)
		ANK repeat	418..449	CDD:293786	11/30 (37%)
		Ank_2	423..513	CDD:372319	28/94 (30%)
		ANK repeat	451..482	CDD:293786	10/30 (33%)
		ANK repeat	484..512	CDD:293786	9/32 (28%)
		Ank_2	489..>565	CDD:372319	15/57 (26%)
		ANK repeat	517..544	CDD:293786	5/24 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910