DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and caskin2

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	XP_004918519.2	Gene:	caskin2 / 100487214	XenbaseID:	XB-GENE-1008062	Length:	1208	Species:	Xenopus tropicalis

Alignment Length:	132	Identity:	41/132 - (31%)
Similarity:	63/132 - (47%)	Gaps:	12/132 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 ERMILWAVNENRISEVREIL--------KLDADT----VNAKDNDGYTPLHRAAYNNFVDMAKLL 101
            |..::.||....:..|:::|        ||...|    ||.:|.||::.||.||.:...::..||
Frog     4 ENELIQAVKSGDVGTVQKLLAKVRTPKSKLLGSTKRLNVNHQDTDGFSALHHAALSGNSELLHLL 68

  Fly   102 LQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTAT 166
            |:..|:.:.:...|..|||.|......:...|||:..|.|||.|...|.|||:.|...:...:.|
Frog    69 LEMQASVDIKDGNGMRPLHYAAWQGQPEPVRLLLRASASVNAASHDGQIPLHLAAQYGHYEVSET 133

  Fly   167 VL 168
            :|
Frog   134 LL 135

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	9/38 (24%)
		ANK	54..169	CDD:238125	40/127 (31%)
		Ank_5	67..120	CDD:290568	19/64 (30%)
		ANK repeat	81..112	CDD:293786	10/30 (33%)
		Ank_5	100..154	CDD:290568	20/53 (38%)
		ANK repeat	114..144	CDD:293786	11/29 (38%)
		ANK repeat	147..180	CDD:293786	7/22 (32%)
caskin2	XP_004918519.2	Ank_4	7..69	CDD:372654	17/61 (28%)
		ANK repeat	7..46	CDD:293786	9/38 (24%)
		PHA02875	40..>279	CDD:165206	33/96 (34%)
		ANK repeat	48..79	CDD:293786	10/30 (33%)
		ANK repeat	81..112	CDD:293786	12/30 (40%)
		ANK repeat	114..145	CDD:293786	7/22 (32%)
		ANK repeat	150..186	CDD:293786
		Ank_2	152..251	CDD:403870
		ANK repeat	188..219	CDD:293786
		ANK repeat	221..251	CDD:293786
		SH3_Caskin2	284..345	CDD:212996
		SAM_caskin1,2_repeat1	469..534	CDD:188896
		SAM_caskin1,2_repeat2	535..605	CDD:188897
		Caskin-Pro-rich	747..831	CDD:407141
		FtsN	<932..>1010	CDD:225629
		Caskin-tail	<1175..1208	CDD:406925
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910