DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and ankrd49

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_004912165.2 Gene:ankrd49 / 100487113 XenbaseID:XB-GENE-479219 Length:776 Species:Xenopus tropicalis


Alignment Length:235 Identity:48/235 - (20%)
Similarity:85/235 - (36%) Gaps:76/235 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DEKSQVEKLRHAKVPRGMFVSGWDDDADEL------------IEEDKNPQSSIERMILWAVNENR 60
            ||.|:..||             |..:.|.|            |...:.|:|:  |.....|.||:
 Frog   219 DEYSEPAKL-------------WRVEKDHLYSISLSTPTNPCIITIQTPKST--RPNTLPVQENK 268

  Fly    61 ISEVREILKLDADTVNAKDND----GYTP-----LHRAAYN-----NFVDMAKLLLQYHANPNAR 111
            ::|| .:....:.|...||.:    .|||     ..::.||     :::...|.:: :.::.:..
 Frog   269 MTEV-ALATSFSTTEEPKDPNLDSLEYTPQDSRGSSKSNYNQADKISYIADRKFVV-FESSLDKL 331

  Fly   112 TELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSN----CRNTATVLLLDR 172
            ..|      ..|:.|..:            ..|:..|:...||..::.|    |||....|..:.
 Frog   332 LRL------IPCQHNEGE------------KCEAPIKEIQKHIDGSMVNIQLLCRNNHKSLYWNS 378

  Fly   173 YIQPRKEN----NSEELASVIARRTGMSFPIFESGEEAYD 208
              ||...:    |....:|::.  :|:|   |:..:|.||
 Frog   379 --QPMTSDMAVGNILMSSSIVL--SGLS---FQKVKEMYD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 6/26 (23%)
ANK 54..169 CDD:238125 25/132 (19%)
Ank_5 67..120 CDD:290568 10/66 (15%)
ANK repeat 81..112 CDD:293786 6/44 (14%)
Ank_5 100..154 CDD:290568 5/53 (9%)
ANK repeat 114..144 CDD:293786 3/29 (10%)
ANK repeat 147..180 CDD:293786 10/36 (28%)
ankrd49XP_004912165.2 THAP 5..94 CDD:398893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4334
OMA 1 1.010 - - QHG48821
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007458
OrthoInspector 1 1.000 - - oto104003
Panther 1 1.100 - - LDO PTHR24144
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4168
SonicParanoid 1 1.000 - - X5588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.