DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and si:dkeyp-9d4.3

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	XP_009304428.1	Gene:	si:dkeyp-9d4.3 / 100148061	ZFINID:	ZDB-GENE-110914-175	Length:	1558	Species:	Danio rerio

Alignment Length:	120	Identity:	36/120 - (30%)
Similarity:	60/120 - (50%)	Gaps:	12/120 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 ERMILWAVNENRISEVREILKLDAD------------TVNAKDNDGYTPLHRAAYNNFVDMAKLL 101
            |:.:|.||....:..|:.:|:....            .||.:|.||.:.||.||.|..|::..||
Zfish     4 EQELLQAVKTEDLVTVQRLLQRPKQGKAKLLGAAKKVNVNFQDTDGLSALHHAALNGNVELISLL 68

  Fly   102 LQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITA 156
            |:..:..:.:.:.|..|||.|......:...:||:.|:.||::||..|.|||:::
Zfish    69 LESQSVVDIKDQKGMRPLHYAAWQGKCEPMKMLLKAGSSVNSQSDEGQIPLHLSS 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	7/38 (18%)
		ANK	54..169	CDD:238125	34/115 (30%)
		Ank_5	67..120	CDD:290568	17/64 (27%)
		ANK repeat	81..112	CDD:293786	11/30 (37%)
		Ank_5	100..154	CDD:290568	18/53 (34%)
		ANK repeat	114..144	CDD:293786	10/29 (34%)
		ANK repeat	147..180	CDD:293786	4/10 (40%)
si:dkeyp-9d4.3	XP_009304428.1	Ank_4	7..69	CDD:290365	17/61 (28%)
		ANK repeat	7..46	CDD:293786	7/38 (18%)
		ANK	43..168	CDD:238125	29/81 (36%)
		ANK repeat	48..79	CDD:293786	11/30 (37%)
		Ank_2	53..145	CDD:289560	25/71 (35%)
		ANK repeat	81..112	CDD:293786	10/30 (33%)
		ANK	109..238	CDD:238125	7/15 (47%)
		ANK repeat	114..145	CDD:293786	4/10 (40%)
		Ank_2	119..215	CDD:289560	2/5 (40%)
		ANK repeat	148..183	CDD:293786
		ANK repeat	185..216	CDD:293786
		Ank_5	205..258	CDD:290568
		ANK repeat	218..248	CDD:293786
		SH3	281..342	CDD:302595
		Caskin1-CID	449..533	CDD:293208
		SAM	587..650	CDD:197735
		SAM_caskin1,2_repeat1	590..654	CDD:188896
		SAM_caskin1,2_repeat2	655..722	CDD:188897
		SAM	661..723	CDD:197735
		Caskin-tail	1501..1558	CDD:293238
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910