DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and gja3

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001107721.1 Gene:gja3 / 100135710 XenbaseID:XB-GENE-494161 Length:414 Species:Xenopus tropicalis


Alignment Length:101 Identity:22/101 - (21%)
Similarity:32/101 - (31%) Gaps:35/101 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PLHSACKW---NNADC-------AHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVL---- 168
            ||:...:|   |..||       ..:.:.|              :.:.|.||...|...:.    
 Frog   183 PLYRCSRWPCPNTVDCFISRPTEKTIFIIF--------------MLVVACVSLLLNMLEIYHLGW 233

  Fly   169 ------LLDRYIQPRKENNSEELASVIARRTGMSFP 198
                  :.:||| |....|..|..|.....:.||||
 Frog   234 KKLKQGMTNRYI-PDPSCNKSEPPSPQTAPSSMSFP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786
ANK 54..169 CDD:238125 11/70 (16%)
Ank_5 67..120 CDD:290568 1/1 (100%)
ANK repeat 81..112 CDD:293786
Ank_5 100..154 CDD:290568 7/45 (16%)
ANK repeat 114..144 CDD:293786 7/35 (20%)
ANK repeat 147..180 CDD:293786 8/42 (19%)
gja3NP_001107721.1 Connexin 3..233 CDD:365820 11/63 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165173129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.