DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN5-p25 and GAMMA CA1

DIOPT Version :9

Sequence 1:NP_723893.1 Gene:DCTN5-p25 / 34873 FlyBaseID:FBgn0040228 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_564091.1 Gene:GAMMA CA1 / 838545 AraportID:AT1G19580 Length:275 Species:Arabidopsis thaliana


Alignment Length:145 Identity:36/145 - (24%)
Similarity:64/145 - (44%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GAIIRGDLANVRTGRYCVIGKNSVIRPPYKQFSKGIAFFPMHVGEHVFVGEGAVVSAATIGSYVY 109
            |.::|||:..|..|....|..||::.......|..:  .|..:|::|.:|..||:...|:....:
plant    82 GCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKV--HPTIIGDNVTIGHSAVLHGCTVEDETF 144

  Fly   110 IGKNAIIGRRCVLKDCCVIEDGAVLPPETTVSSYMRYTARGTIEGGQGNPYFVPAAMQDE---MI 171
            ||..|.:....|::...::..||::...|.:.|       |.:.|  |||......:.||   .|
plant   145 IGMGATLLDGVVVEKHGMVAAGALVRQNTRIPS-------GEVWG--GNPARFLRKLTDEEIAFI 200

  Fly   172 NYTKSFYEHFVRAPA 186
            :.:.:.|.:..:|.|
plant   201 SQSATNYSNLAQAHA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN5-p25NP_723893.1 LbH_Dynactin_5 13..178 CDD:100049 33/135 (24%)
GAMMA CA1NP_564091.1 PLN02296 1..269 CDD:215167 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2686
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.