DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN5-p25 and GAMMA CAL1

DIOPT Version :9

Sequence 1:NP_723893.1 Gene:DCTN5-p25 / 34873 FlyBaseID:FBgn0040228 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001190608.1 Gene:GAMMA CAL1 / 836470 AraportID:AT5G63510 Length:279 Species:Arabidopsis thaliana


Alignment Length:179 Identity:43/179 - (24%)
Similarity:76/179 - (42%) Gaps:49/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NIILNGKVI------VQSGAIIRGDLANVRTG------RYCVI-------------------GKN 66
            |::|.|:|.      |.:||::||||..:..|      ..||:                   |..
plant    77 NVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQERCVVHAAWSSPTVGCNGDKAVSHGCE 141

  Fly    67 SVIRPPYKQ--FSKGIAFFPMH--VGEHVFVGEGAVVSAATIGSYVYIGKNAIIGRRCVLKDCCV 127
            .|..|.::|  ||:    .|..  :..:|.||..:::.:.||.....||:::|:....:::...:
plant   142 LVFAPRFRQGKFSR----LPAATIIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSI 202

  Fly   128 IEDGAVLPPETTVSSYMRYTARGTIEGGQGNP-YFVPAAMQDEMINYTK 175
            :|.|:|:||...:.|       |.:.|  ||| .|:.....:|.:...|
plant   203 LEAGSVVPPGRRIPS-------GELWG--GNPARFIRTLTNEETLEIPK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN5-p25NP_723893.1 LbH_Dynactin_5 13..178 CDD:100049 43/179 (24%)
GAMMA CAL1NP_001190608.1 PLN02472 2..279 CDD:215263 43/179 (24%)
LbH_gamma_CA_like 67..251 CDD:100051 43/179 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2686
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.