DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN5-p25 and LpxD2

DIOPT Version :9

Sequence 1:NP_723893.1 Gene:DCTN5-p25 / 34873 FlyBaseID:FBgn0040228 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_193854.2 Gene:LpxD2 / 827871 AraportID:AT4G21220 Length:304 Species:Arabidopsis thaliana


Alignment Length:148 Identity:33/148 - (22%)
Similarity:49/148 - (33%) Gaps:37/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TASGNKVSRHTVLCGSQNIILNGKVIVQSG----------AIIRGDLANVRTGRYCVIGKNSVI- 69
            |..|..||......|...:|.||..|.|.|          .:.:....||:.|....||.|:.| 
plant   129 TRIGYNVSISNCSIGDSCVIHNGVCIGQDGFGFYVDEHGNMVKKPQTLNVKIGNRVEIGANTCID 193

  Fly    70 RPPYKQFSKGIAFFPMHVGEHVFVGEGAVVSAATIGSYVYIGKNAIIGRRCVLKDCCVIEDGAVL 134
            |..::                    |..:.....|.:.|.||.|.|||:      ||::.....:
plant   194 RGSWR--------------------ETVIEDDTKIDNLVQIGHNVIIGK------CCLLCGQVGI 232

  Fly   135 PPETTVSSYMRYTARGTI 152
            ....|:..|:....|..:
plant   233 AGSVTIGDYVALGGRAAV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN5-p25NP_723893.1 LbH_Dynactin_5 13..178 CDD:100049 33/148 (22%)
LpxD2NP_193854.2 LbH_LpxD 86..290 CDD:100043 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.