DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN5-p25 and LpxD1

DIOPT Version :9

Sequence 1:NP_723893.1 Gene:DCTN5-p25 / 34873 FlyBaseID:FBgn0040228 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_192430.2 Gene:LpxD1 / 825869 AraportID:AT4G05210 Length:330 Species:Arabidopsis thaliana


Alignment Length:139 Identity:29/139 - (20%)
Similarity:51/139 - (36%) Gaps:59/139 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KD--EYVETASGNKVSR------------HTVLCGSQNIILNGKVIVQSGAIIRGDLANVRTGRY 60
            ||  :.:||:||..|.:            |      ::.:::...:|:.||::..:         
plant    62 KDVHDLLETSSGGNVEKGFLRWRNGGGMYH------RSALIDSSALVEFGAVVHQE--------- 111

  Fly    61 CVIGKNSVIRPPYKQFSKGIAFFPMHVGEHVFVGEGAVVSAATIGSYVYIGKNAIIGRRCVLKDC 125
            .::|..                  :|:|           |...|||.|.||.:..|| .|.:.|.
plant   112 AILGAE------------------VHIG-----------SNTVIGSSVKIGPSTKIG-NCSIGDL 146

  Fly   126 CVIEDGAVL 134
            |||.:|..:
plant   147 CVIHNGVCI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN5-p25NP_723893.1 LbH_Dynactin_5 13..178 CDD:100049 27/134 (20%)
LpxD1NP_192430.2 LbH_LpxD 93..289 CDD:100043 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.