DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN5-p25 and GAMMA CAL2

DIOPT Version :9

Sequence 1:NP_723893.1 Gene:DCTN5-p25 / 34873 FlyBaseID:FBgn0040228 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_190437.1 Gene:GAMMA CAL2 / 824029 AraportID:AT3G48680 Length:256 Species:Arabidopsis thaliana


Alignment Length:150 Identity:37/150 - (24%)
Similarity:71/150 - (47%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NIILNGKVI------VQSGAIIRGDLANVRTGRYCVIGKNSVIRPPYKQFSKGIAFFPMHVGEHV 91
            |::|.|:|.      |.:||::||||..:..|....:.:..|:...:.. ..|:....: :..:|
plant    81 NVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQERCVVHAAWSS-PTGLPAQTL-IDRYV 143

  Fly    92 FVGEGAVVSAATIGSYVYIGKNAIIGRRCVLKDCCVIEDGAVLPPETTVSSYMRYTARGTIEGGQ 156
            .||..:::.:.||.....||:::|:....:::...::|.|:||||...:.|       |.:.|  
plant   144 TVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAGSVLPPGRRIPS-------GELWG-- 199

  Fly   157 GNP-YFVPAAMQDEMINYTK 175
            ||| .|:.....:|.:...|
plant   200 GNPARFIRTLTNEETLEIPK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN5-p25NP_723893.1 LbH_Dynactin_5 13..178 CDD:100049 36/149 (24%)
GAMMA CAL2NP_190437.1 PLN02472 2..256 CDD:215263 36/149 (24%)
LbH_gamma_CA_like 71..228 CDD:100051 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2686
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.