DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN5-p25 and Dctn5

DIOPT Version :9

Sequence 1:NP_723893.1 Gene:DCTN5-p25 / 34873 FlyBaseID:FBgn0040228 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_067621.3 Gene:Dctn5 / 59288 MGIID:1891689 Length:182 Species:Mus musculus


Alignment Length:182 Identity:106/182 - (58%)
Similarity:138/182 - (75%) Gaps:5/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEIPDTYYSKDEYVETASGNKVSRHTVLCGSQNIILNGKVIVQSGAIIRGDLANVRTGRYCVIGK 65
            ||:.:..|:|.||:||||||||||.:||||||||:||||.|:.:..||||||||||.||:||:..
Mouse     1 MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLANVRVGRHCVVKS 65

  Fly    66 NSVIRPPYKQFSKGIAFFPMHVGEHVFVGEGAVVSAATIGSYVYIGKNAIIGRRCVLKDCCVIED 130
            .||||||:|:||||:||||:|:|:|||:.|..||:||.|||||::|||.:|||||||||||.|.|
Mouse    66 RSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILD 130

  Fly   131 GAVLPPETTVSSYMRYTARGTIEGGQGNPYFVPAAMQDEMINYTKSFYEHFV 182
            ..||||||.|..:..::....:..|:     :|...|:.||:.|||:|:.|:
Mouse   131 NTVLPPETVVPPFTVFSGCPGLFSGE-----LPECTQELMIDVTKSYYQKFL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN5-p25NP_723893.1 LbH_Dynactin_5 13..178 CDD:100049 99/164 (60%)
Dctn5NP_067621.3 LbH_Dynactin_5 13..173 CDD:100049 99/164 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835042
Domainoid 1 1.000 151 1.000 Domainoid score I4361
eggNOG 1 0.900 - - E1_KOG3121
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10998
Inparanoid 1 1.050 226 1.000 Inparanoid score I3483
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54761
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007318
OrthoInspector 1 1.000 - - oto94056
orthoMCL 1 0.900 - - OOG6_103929
Panther 1 1.100 - - LDO PTHR46126
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4294
SonicParanoid 1 1.000 - - X5427
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.