DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mol and DUOXA1

DIOPT Version :9

Sequence 1:NP_001036362.1 Gene:mol / 34872 FlyBaseID:FBgn0086711 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001263193.1 Gene:DUOXA1 / 90527 HGNCID:26507 Length:483 Species:Homo sapiens


Alignment Length:419 Identity:129/419 - (30%)
Similarity:188/419 - (44%) Gaps:74/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DVSIVAVSVLFATFYVAFLVIFPGVR-KQKFTTFSTVTLSLFVGLVILITRLGSAWHVAHATIIA 91
            |.::.::.::|.|....|:||.||:| |.:......|..|||:|..||.....|.|.|...:...
Human    21 DTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAVNFSSEWSVGQVSTNT 85

  Fly    92 PYKAFSREKLPARIGTHIGLMHVNVTLTAIPIG--NWTPPDIDYNERFTWEGANDMSANYRHALQ 154
            .|||||.|.:.|.||..:||..||:|||..|:.  |.|   |:|||.|||....:.:..|..||:
Human    86 SYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNET---INYNEEFTWRLGENYAEEYAKALE 147

  Fly   155 RGLPFPILTVAEYFSLGREGFSWGGQYRAAGYFASIMLWASLASWLLMNLLL-IAVPRYGAYMKA 218
            :|||.|:|.:||.|: .|.......|||.||::.|.|||.:...|||.|::| :.|..||.||..
Human   148 KGLPDPVLYLAEKFT-PRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLL 211

  Fly   219 LTG-----ALL---VCTTVGYHCLLPKRPLSIHLEGGRLEFHFGWCYWLVLVAGILCFIAGVLIS 275
            .||     |||   :.|::       ..|..:||....|..|.|..:|:.|..|:||.:.|:.::
Human   212 ATGIFQLLALLFFSMATSL-------TSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMA 269

  Fly   276 IIDLVWPHTFSTVLEVYYGTPYDRHVILEESSD------VRYRKPRNSRSLEDPPGLGSRILRRL 334
            :...:.||.    |:.::....|...:||.|.:      .|||...:|...:|.|          
Human   270 VAHRMQPHR----LKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIP---------- 320

  Fly   335 SSKARDLQPGTAPRRDS----------PAGVSSSGGV-----------------ENKGFQSDAPK 372
            .|:|...:....|||.|          ||.:|:..|.                 ..|..:...|.
Human   321 LSEASSTKAYYRPRRLSLVPADVRGLAPAALSALPGALLAQAWRALLPGLRCPKAGKESRLGPPH 385

  Fly   373 SPWRY-PFRRSQQMAQQQHSHPLHQHPLQ 400
            ||||: |....::.|:.....|   .||:
Human   386 SPWRFGPEGCEERWAEHTGDSP---RPLR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
molNP_001036362.1 DuoxA 18..289 CDD:287209 97/272 (36%)
DUOXA1NP_001263193.1 DuoxA 11..283 CDD:402003 98/276 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142562
Domainoid 1 1.000 159 1.000 Domainoid score I4092
eggNOG 1 0.900 - - E1_KOG3921
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H16043
Inparanoid 1 1.050 165 1.000 Inparanoid score I4188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D360121at33208
OrthoFinder 1 1.000 - - FOG0003131
OrthoInspector 1 1.000 - - otm41042
orthoMCL 1 0.900 - - OOG6_106442
Panther 1 1.100 - - O PTHR31158
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7905
SonicParanoid 1 1.000 - - X3013
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.