DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mol and Duoxa2

DIOPT Version :9

Sequence 1:NP_001036362.1 Gene:mol / 34872 FlyBaseID:FBgn0086711 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001178894.1 Gene:Duoxa2 / 499879 RGDID:1560628 Length:320 Species:Rattus norvegicus


Alignment Length:324 Identity:99/324 - (30%)
Similarity:146/324 - (45%) Gaps:34/324 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VSIVAVSVLFATFYVAFLVIFPGVR-KQKFTTFSTVTLSLFVGLVILITRLGSAWHVAHATIIAP 92
            |.::.|.::|.:...:||.|.||:| ..::.....|.||||:|..|:.......|.|........
  Rat    22 VPLLIVILVFLSLAASFLFILPGIRGHSRWFWLVRVLLSLFIGAEIVAVHFSGDWFVGRVWTNTS 86

  Fly    93 YKAFSREKLPARIGTHIGLMHVNVTLTAIPIG--NWTPPDIDYNERFTWEGANDMSANYRHALQR 155
            |||||..::...:|.|:||..||:||...|:.  |.|   |||||:|||....|.:..|..||::
  Rat    87 YKAFSTSRVQVHVGLHVGLEGVNITLRGTPMQQLNET---IDYNEQFTWRLNEDYTKEYVQALEK 148

  Fly   156 GLPFPILTVAEYFSLGREGFSWGG---QYRAAGYFASIMLWASLASWLLMNLLL-IAVPRYGAYM 216
            |||.|:|.:||.|:..    |..|   ||..||::|...||.:...|::.|.|| :..|.||...
  Rat   149 GLPDPVLYLAEKFTPN----SPCGLYHQYHYAGHYAGATLWVAFCFWIIANALLSMPAPLYGGLA 209

  Fly   217 KALTGALLVCTTVGYHCLLPKRPLSIHLEGGRLEFHFGWCYWLVLVAGILCFIAGVLISIIDLVW 281
            ..:|||..:.:...:..:.........|....|..|:|..:|:.|..|||..:.|.|:.|:....
  Rat   210 LLITGAFTLFSVFAFASISSVPLCHFRLGSAALTPHYGASFWVTLATGILSLLLGGLVVILHYTR 274

  Fly   282 PHTFSTVLEVYYGTPYDRHVILEESSDVRYRKPRNSRSLEDPPGLGSRILRRLSSKARDLQPGT 345
            |.....:|        |::|     .|...:...||..:.|.|       :...||..||...|
  Rat   275 PSVLRALL--------DQNV-----KDCSNQADGNSHFILDNP-------QHRQSKTPDLNVTT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
molNP_001036362.1 DuoxA 18..289 CDD:287209 86/266 (32%)
Duoxa2NP_001178894.1 DuoxA 11..282 CDD:402003 86/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336062
Domainoid 1 1.000 158 1.000 Domainoid score I4026
eggNOG 1 0.900 - - E1_KOG3921
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4177
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D360121at33208
OrthoFinder 1 1.000 - - FOG0003131
OrthoInspector 1 1.000 - - otm45177
orthoMCL 1 0.900 - - OOG6_106442
Panther 1 1.100 - - O PTHR31158
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3013
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.