DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mol and DUOXA2

DIOPT Version :9

Sequence 1:NP_001036362.1 Gene:mol / 34872 FlyBaseID:FBgn0086711 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_016877669.1 Gene:DUOXA2 / 405753 HGNCID:32698 Length:337 Species:Homo sapiens


Alignment Length:291 Identity:97/291 - (33%)
Similarity:140/291 - (48%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VSIVAVSVLFATFYVAFLVIFPGVR-KQKFTTFSTVTLSLFVGLVILITRLGSAWHVAHATIIAP 92
            |.::.|.::|.....:||:|.||:| ..::.....|.||||:|..|:.....:.|.|........
Human    22 VPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTS 86

  Fly    93 YKAFSREKLPARIGTHIGLMHVNVTLTAI-------------PIGNWTP-----PDIDYNERFTW 139
            |||||..::.||:...:||..:|:|||..             |.|  ||     ..|||||:|||
Human    87 YKAFSAARVTARVRLLVGLEGINITLTVARSPTAGSPMSPPHPTG--TPVHQLNETIDYNEQFTW 149

  Fly   140 EGANDMSANYRHALQRGLPFPILTVAEYFSLGREGFSWGG---QYRAAGYFASIMLWASLASWLL 201
            ....:.:|.|.:||::|||.|:|.:||.|:..    |..|   ||..||::||..||.:...|||
Human   150 RLKENYAAEYANALEKGLPDPVLYLAEKFTPS----SPCGLYHQYHLAGHYASATLWVAFCFWLL 210

  Fly   202 MNLLL-IAVPRYGAYMKALTGALLVCTTVGYHCL-----LPKRPLSIHLEGGRLEFHFGWCYWLV 260
            .|:|| ...|.||......|||..:   .|...|     :|..||  .|....|...:|..:|:.
Human   211 SNVLLSTPAPLYGGLALLTTGAFAL---FGVFALASISSVPLCPL--RLGSSALTTQYGAAFWVT 270

  Fly   261 LVAGILC-FIAGVLISIIDLVWPHTFSTVLE 290
            |..|:|| |:.|.::| :..|.|....|:|:
Human   271 LATGVLCLFLGGAVVS-LQYVRPSALRTLLD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
molNP_001036362.1 DuoxA 18..289 CDD:287209 96/288 (33%)
DUOXA2XP_016877669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142561
Domainoid 1 1.000 159 1.000 Domainoid score I4092
eggNOG 1 0.900 - - E1_KOG3921
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D360121at33208
OrthoFinder 1 1.000 - - FOG0003131
OrthoInspector 1 1.000 - - otm41042
orthoMCL 1 0.900 - - OOG6_106442
Panther 1 1.100 - - O PTHR31158
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7905
SonicParanoid 1 1.000 - - X3013
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.