DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mol and LOC101733132

DIOPT Version :9

Sequence 1:NP_001036362.1 Gene:mol / 34872 FlyBaseID:FBgn0086711 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_004918326.1 Gene:LOC101733132 / 101733132 -ID:- Length:307 Species:Xenopus tropicalis


Alignment Length:309 Identity:98/309 - (31%)
Similarity:156/309 - (50%) Gaps:28/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGGPTLYSFSNRTPVTGDVSIVAVSVLFATFYVAFLVIFPGVR-KQKFTTFSTVTLSLFVGLVIL 74
            ||....|. ..|.|...:|..:.:.::|..|.::|:||.||:| :.:.:....:..|||:|.||:
 Frog     5 DGQYPFYP-HERKPWVFNVQCIIIIIVFLVFALSFIVILPGIRGRGRISWACRIITSLFIGTVIV 68

  Fly    75 ITRLGSAWHVAHATIIAPYKAFSREKLPARIGTHIGLMHVNVTLTAIPIG--NWTPPDIDYNERF 137
            .....|.|.|...:....||:||...:.|.||..:||..:||||...||.  |.|   |:|||.|
 Frog    69 AVNFTSDWEVGSVSATTTYKSFSNAVVNADIGLRVGLNGINVTLKGNPIHQINET---INYNEEF 130

  Fly   138 TWEGANDMSANYRHALQRGLPFPILTVAEYFSLGREGFSWGG---QYRAAGYFASIMLWASLASW 199
            .|...:|.:..|...|::|||.|||.|||.|:    .::..|   |||.:|::||..:|.:..||
 Frog   131 AWSFGSDYNQYYDDGLKKGLPNPILYVAEKFT----QYNPCGMFAQYRISGHYASACMWVAFCSW 191

  Fly   200 LLMNLLLIAVPR--YGAYMKALTGALLVCTTVGYHCLLPKRPLSIHLEGGRLEFHFGWCYWLVLV 262
            ::.| :|.::|.  |||||..:|.|.::.:.:.:..:......:|......|:..||..:||.|.
 Frog   192 IICN-ILFSMPSFIYGAYMILVTAAFIIFSLISFSTVRNVSFCNIQFGTDVLKTEFGPSFWLTLA 255

  Fly   263 AGILCFIAGVLISIIDLVWPHTFSTVLEVYYGTPYDRHVILEESSDVRY 311
            .|:|||..|:...::|...|..    |:|::.       ::||..:..|
 Frog   256 TGLLCFFIGITFIVLDRCVPEK----LKVFFN-------MIEEDEEEYY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
molNP_001036362.1 DuoxA 18..289 CDD:287209 90/278 (32%)
LOC101733132XP_004918326.1 DuoxA 11..282 CDD:370880 93/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4220
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4206
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D360121at33208
OrthoFinder 1 1.000 - - FOG0003131
OrthoInspector 1 1.000 - - otm48245
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3013
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.