DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProtA and ProtB

DIOPT Version :9

Sequence 1:NP_001285945.1 Gene:ProtA / 34866 FlyBaseID:FBgn0013300 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_477051.1 Gene:ProtB / 34867 FlyBaseID:FBgn0013301 Length:144 Species:Drosophila melanogaster


Alignment Length:144 Identity:133/144 - (92%)
Similarity:138/144 - (95%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPIRRAPQKCKPMKSCAKPRRKAACAKATRP 65
            ||||||||||||||||||||||||||||||||||||.||||.|||||||||||||||||||||||
  Fly     1 MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSCAKPRRKAACAKATRP 65

  Fly    66 KVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLKPRELIAKAAKAWARLSENRKDRYRRMACK 130
            ||||||.|||||||||||||||||||.||||||:|||:||||:||||||.|.|:|||||||||||
  Fly    66 KVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDLKPQELIAEAAKAWAELPEHRKDRYRRMACK 130

  Fly   131 VTTSERHKRRRICQ 144
            |||||||||||||:
  Fly   131 VTTSERHKRRRICK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProtANP_001285945.1 DUF1074 60..146 CDD:283927 76/85 (89%)
ProtBNP_477051.1 DUF1074 60..>144 CDD:283927 75/83 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8XZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008546
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7636
54.740

Return to query results.
Submit another query.