DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProtA and CG46192

DIOPT Version :9

Sequence 1:NP_001285945.1 Gene:ProtA / 34866 FlyBaseID:FBgn0013300 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001303591.1 Gene:CG46192 / 26067070 FlyBaseID:FBgn0267904 Length:133 Species:Drosophila melanogaster


Alignment Length:109 Identity:41/109 - (37%)
Similarity:61/109 - (55%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IRRAPQKCKPMKSCAKPRRKAACAKATRPKVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLK 101
            :|||   |...|.|||.:.:.||.|.           ||:|.||:|:|.|.|||||:|.|||::.
  Fly    36 LRRA---CAKPKVCAKQKAEKACDKV-----------KCTKLGPITSNCYFNFVRSYRIKHCDVN 86

  Fly   102 PRELIAKAAKAWARLSENRKDRYRRMACKVTTSERHKRRRICQQ 145
            |:.||:|||||| |:.:.|..:..:.|.::.......|..:.::
  Fly    87 PQGLISKAAKAW-RMLKTRFSQIEKNAIRIWNKHSELRSDLLEE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProtANP_001285945.1 DUF1074 60..146 CDD:283927 31/86 (36%)
CG46192NP_001303591.1 DUF1074 47..>114 CDD:283927 34/78 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008546
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7636
32.910

Return to query results.
Submit another query.