DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ProtA and CG46191

DIOPT Version :9

Sequence 1:NP_001285945.1 Gene:ProtA / 34866 FlyBaseID:FBgn0013300 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001303590.1 Gene:CG46191 / 26067069 FlyBaseID:FBgn0267903 Length:102 Species:Drosophila melanogaster


Alignment Length:112 Identity:42/112 - (37%)
Similarity:60/112 - (53%) Gaps:24/112 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IRRAPQKCKPMKSCAKPRRKAACAKATRPKVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLK 101
            :|||   |...|.|||.:.:.||.|.           ||:|.||:|:|.|.|||||:|.|||::.
  Fly     5 LRRA---CAKPKVCAKQKAEKACDKV-----------KCTKLGPITSNCYFNFVRSYRIKHCDIN 55

  Fly   102 PRELIAKAAKAW----ARLSENRK------DRYRRMACKVTTSERHK 138
            |:.||:||||||    .|.|:..|      :::..:...:...|.|:
  Fly    56 PQGLISKAAKAWRMLKTRFSQIEKNGIRIWNKHSELRSDLLEEEEHE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ProtANP_001285945.1 DUF1074 60..146 CDD:283927 32/89 (36%)
CG46191NP_001303590.1 DUF1074 16..>83 CDD:283927 34/77 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008546
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7636
32.910

Return to query results.
Submit another query.