Sequence 1: | NP_001188814.1 | Gene: | CG4480 / 34864 | FlyBaseID: | FBgn0032553 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_683487.4 | Gene: | AT1G70505 / 843387 | AraportID: | AT1G70505 | Length: | 358 | Species: | Arabidopsis thaliana |
Alignment Length: | 190 | Identity: | 44/190 - (23%) |
---|---|---|---|
Similarity: | 64/190 - (33%) | Gaps: | 66/190 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 WQSGPKSSIFLAYRWALG----GFFGAGVVGCISEYYNHGN-------FFIFLTNWGFVLCGVTS 100
Fly 101 IAGAILVTIYHYK-PE--------------TWVPP------------SGWIK------------- 125
Fly 126 -VYWACYWTNITLACLIAFAYWTAIYPKDRVLTNPTRVSDLYNIWTHLLPPIFFTIDNFL 184 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |