DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4480 and AT1G70505

DIOPT Version :9

Sequence 1:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_683487.4 Gene:AT1G70505 / 843387 AraportID:AT1G70505 Length:358 Species:Arabidopsis thaliana


Alignment Length:190 Identity:44/190 - (23%)
Similarity:64/190 - (33%) Gaps:66/190 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WQSGPKSSIFLAYRWALG----GFFGAGVVGCISEYYNHGN-------FFIFLTNWGFVLCGVTS 100
            |.:..|.   :...|.||    ||  ..::|.||     ||       .|||.|.|.|.|..:..
plant    93 WNTSVKE---IHPNWLLGFRVFGF--VVLLGLIS-----GNAIADGTGIFIFYTQWTFTLVTIYF 147

  Fly   101 IAGAILVTIYHYK-PE--------------TWVPP------------SGWIK------------- 125
            ..|: ||:||.:: |:              |:.||            ||..:             
plant   148 GLGS-LVSIYRFRSPDNGENRVSIVDEEQGTYRPPGNAENSNVFKSSSGHDRENMSTRQVATTLG 211

  Fly   126 -VYWACYWTNITLACLIAFAYWTAIYPKDRVLTNPTRVSDLYNIWTHLLPPIFFTIDNFL 184
             ::...:.|......|....:|..|||   .||......|.:.:..|.:..||...:.||
plant   212 YIHQILFQTCAGAVLLTDGVFWFIIYP---FLTAKDFNLDFFIVIMHSVNAIFLLGETFL 268



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.