DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4480 and AT5G62960

DIOPT Version :9

Sequence 1:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_201101.2 Gene:AT5G62960 / 836416 AraportID:AT5G62960 Length:347 Species:Arabidopsis thaliana


Alignment Length:257 Identity:51/257 - (19%)
Similarity:86/257 - (33%) Gaps:103/257 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NWGFVLC----GVTSIAGAILVTIYH-----------------------YKPETWVPPSGWIKVY 127
            ||..::|    .:.::..|.|:..|.                       |:.|||.|        
plant    37 NWRVMICCIWMAIATVITAFLIFKYEGFRRKRSDVGEVDGGEKEWSGNVYEDETWRP-------- 93

  Fly   128 WACYWTNITLACLIAF---AYWTAIYPKDRV--LTNPTRVSDLYNIWTHLLPPIFFTIDNFLVAQ 187
              |. .||..|.|:||   |::..:.....:  :..|| :...|..||..|..::|.:.:.|   
plant    94 --CL-RNIHPAWLLAFRVVAFFVLLVMLIVIGLVDGPT-IFFYYTQWTFGLITLYFGLGSLL--- 151

  Fly   188 PARLLHFVY---------------------------------------PLAFLHTYG-IFAILFY 212
               .||..|                                       |..|   :| :|.|:|.
plant   152 ---SLHGCYQYNKRAAGDRVDSIEAIDSERARSKGADNTIQQSQYSSNPAGF---WGYVFQIIFQ 210

  Fly   213 ALGGRNL--DGKHY--IYPFL---NFARPKIVLKTVTYLSIVLV---SLSSLEYGVYRLRNF 264
            ...|..|  |...:  |.|||   :::...:|:...:..:|.|:   :|:||.:..:|:..|
plant   211 MNAGAVLLTDCVFWFIIVPFLEIHDYSLNVLVINMHSLNAIFLLGDAALNSLSFPCFRIAYF 272



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.