DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4480 and AT2G47115

DIOPT Version :9

Sequence 1:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_566096.2 Gene:AT2G47115 / 819324 AraportID:AT2G47115 Length:300 Species:Arabidopsis thaliana


Alignment Length:198 Identity:43/198 - (21%)
Similarity:70/198 - (35%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NFFIFLTNWGFVLCGVTSIAGAILVTIY----HYKPETWVPPSGWI--KV---------YWACYW 132
            :.|::.|.|.|:|. :...|..|:.::|    |.|..|.......:  ||         ...|:.
plant    97 SIFVYYTEWTFMLV-IIYFAMGIVASVYGCLIHLKELTLETDEDVVVEKVGDEFRRRLEVCGCFM 160

  Fly   133 -----TNITLACLIAFAYWTAIYPKDRVLTNPTRVS-DLYNIWTHLLPPIFFTIDNFLVAQPARL 191
                 |:.....|....:|..|.|    ..:.||.. :...|..|.....|..::..|.:.|...
plant   161 QTIFQTSAGAVVLTDIVFWLVIVP----FLSTTRFGLNTLTICMHTANAGFLLLETLLNSLPFPW 221

  Fly   192 LHFVYPLAFLHTYGIFAILFYALGGRNLDGKHYIYPFLNFARPKIVLKTVTYLSIVLVSLSSLEY 256
            ....|.:.:...|.||..:.:|.|     ...:.||||...:|   ...:.||.:.:|.:..  |
plant   222 FRMGYFVLWSCLYVIFQWIIHACG-----FTWWPYPFLELDKP---WAPIWYLCMAIVHIPC--Y 276

  Fly   257 GVY 259
            |.|
plant   277 GAY 279



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.