DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4480 and CG43778

DIOPT Version :9

Sequence 1:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001369129.1 Gene:CG43778 / 34738 FlyBaseID:FBgn0264308 Length:1003 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:108/268 - (40%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LHHHSPTDFLRSQWQSGPKSSI-FLAYRWALGGFFGAGVV------GCISEYYNH--GNFFIFLT 89
            :|.|   :|...|||...:..| :|.|||.......|.:|      |...|::.|  ..::|:||
  Fly   531 VHRH---NFYLCQWQRNTQVRIVYLFYRWITAITCLAALVCSLLDIGRTDEHFEHHYAKWWIYLT 592

  Fly    90 NWGFVLCGVTSIAGAILVT--------------------IYHYKPETWVPPSGWIKVYWACYWTN 134
            :||.:.|.|.:...|.:||                    ::|              :||..|...
  Fly   593 HWGLLFCTVQAWLAAWIVTQGMMVEREDFEIVRQAKKSRLHH--------------LYWVLYTCA 643

  Fly   135 ITLACLIAFAYWTAIYPKDRVLTNP-TRVSDLYNIWTHLLPPIFFTIDNFLVAQPARLLHFVYPL 198
            ...|.::...||..::       || ....|..||..|:|..|...||..:|..|.::.|..:..
  Fly   644 TVYAFIVTMCYWLLVH-------NPEIHKIDALNIMVHVLNTIIMLIDLAIVGHPIKMSHAYFTT 701

  Fly   199 AFLHTYGIFAILFYALGGRNLDGKHYIYPFLNFARP-KIVLKTVTYLSIVLV-SLSSLEYGVYRL 261
            .....|.||..:::..||.:...:..|||.:::.:| |.::  ||..:|:.. .:....|.:||.
  Fly   702 GIGLAYAIFTGIYFLAGGTDRKNQTAIYPMMDWTKPGKAII--VTACAIIFTFFVHFCCYLLYRG 764

  Fly   262 RNFIARKL 269
            |.::..||
  Fly   765 RVWLFTKL 772



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.