DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4480 and rost

DIOPT Version :9

Sequence 1:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:132/260 - (50%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLRDELRFRRLGLHHHSPTDFLRSQWQSGPKSSIFLAYRWALGGFFGAGVVGCISEYYNHGNFFI 86
            |...||:....|..::....|.|||||....::|:|.|||....||....:.|:...:..|.|||
  Fly    10 SFNKELQRANFGFAYNRVHLFYRSQWQKDEINTIYLLYRWIWALFFLGVYIMCVIVQFCDGKFFI 74

  Fly    87 FLTNWGFVLCGVTSIAGAILVTIYHY--------------KPETWVPPSGWIKVYWACYWTNITL 137
            ::|||||.||.:|.:..|:.||.:|:              |.||    |..:|:||..|...::|
  Fly    75 YMTNWGFGLCTITMLISAVQVTCWHFDVRSTRSLVQESGHKAET----SRGLKIYWWLYNMTLSL 135

  Fly   138 ACLIAFAYWTAIYPKDRVLTNPTRVSDLYNIWTHLLPPIFFTIDNFLVAQPARLLHFVYPLAFLH 202
            |.:|:..||..::.|   :..|.|...: :|.||.:..:...||..::|.|.|:||.||.::...
  Fly   136 ALIISTVYWVFLHGK---MNKPMRFPAI-SIITHGMNSVMMLIDFLVIAFPLRILHMVYGMSLAI 196

  Fly   203 TYGIFAILFYALGGRNLDGKHYIYPFLNFARPKIVLKTVTYLSIVLVSLSSLEYGVYRLRNFIAR 267
            .:.:|.::::..||.:..|.||:||.|::..|...:.|...:.::::....|.:|:|:|:....|
  Fly   197 FFFLFTLIYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGIFLLIMCYWVLLFGLYKLKRMFNR 261

  Fly   268  267
              Fly   262  261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4480NP_001188814.1 None
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 60/209 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 1 1.000 - - FOG0009967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.