DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4480 and LOC103911277

DIOPT Version :9

Sequence 1:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_021332981.1 Gene:LOC103911277 / 103911277 -ID:- Length:326 Species:Danio rerio


Alignment Length:274 Identity:67/274 - (24%)
Similarity:115/274 - (41%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDELRFRRLGLHHHSPTDFLRSQWQSGPKSSIFLAYR-----WALGGFFGAGVVGCISEYYNHGN 83
            ::|...::|......|...|:.:|...|  .::|.||     ::|..|....::      :|...
Zfish    12 KEEFTVQKLHFFTSKPELLLQPRWDIPP--VLWLVYRCFMLVYSLSWFIYTALL------FNTPK 68

  Fly    84 FFIFLTN------------------WGF--VLC--------GVTSIAGAILVTIYHYKPETWVPP 120
            |||||::                  |.|  :.|        ||:....|:|        ...:|.
Zfish    69 FFIFLSHISYCLMVIYYLLAFCNLAWAFLEIRCCSHRRKRAGVSIECEALL--------SLSLPL 125

  Fly   121 SGWIKVYWACYWTNITLACLIAFAYWTAIYPK-DRVLTNPTRVSDLYNIWTHLLPPIFFTIDNFL 184
            ...:.:.|..:......:..::|.|||.|:|. ...||       .:||..|.:..:...:|..|
Zfish   126 YTALNLQWLLHSVMGCFSLSVSFLYWTIIHPSHQHSLT-------AFNINIHFINSVQTAVDLLL 183

  Fly   185 VAQPARLLHFVYPLAFLHTYGIFAILFYALGGRNLDGKHYIYPFLNF-ARPKIVLKTVTYLSIVL 248
            ...|..|.||:||:.....|.|||::::.:||.|..|:.|||..|:| .||  :|.|::.|.:.|
Zfish   184 SCTPVHLTHFIYPVLAAILYIIFAVVYWLMGGTNQSGQPYIYSILDFGGRP--LLATLSILGVCL 246

  Fly   249 VSLSSLEYGVYRLR 262
            |.|...:..:::|:
Zfish   247 VCLPFCQLLLWKLQ 260



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.