DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG34409

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:308 Identity:77/308 - (25%)
Similarity:124/308 - (40%) Gaps:71/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSVVIGISALLFLLPVPGSSQYLDGRCGL-----LTNGKIANNISSPWM---AYLH--TSELLY 55
            ::::...:|.....:| |.:.:...| ||:     |..|..|:....||:   ||.:  :|.:.:
  Fly   217 IETIPASLSTTTASMP-PFAQENTQG-CGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISF 279

  Fly    56 VCGGTVITEKLVLTAAHCTRASEQLVARIGEF------IGTDDANDTMLSEYQVSQTFIHSLYNT 114
            .|.|::|:...::|||||      :|..:.:.      :|:.|.    .:.:.:.|..:|..|:.
  Fly   280 RCSGSLISSNHIVTAAHC------VVNLVSDLELSHVRLGSQDG----ATPFAIEQVIVHPNYDQ 334

  Fly   115 TTSANDIAILGLATDIVFSKTIRPICIVW---WTIWRKYIDNIQVLSGAQWGLPNDRNES----- 171
            ...|||||:|.:.:.   :.|..|||:.:   .|:..:.|..|.|.:|  |.:.:..|.|     
  Fly   335 PKYANDIALLRINST---NGTFTPICLPFNGPITLGNRLIGQIGVAAG--WSIGSTENNSSMDPS 394

  Fly   172 -DAFRITDIRRQPANMCSTLNGTAILSSQF-----------CA-GDSDSKLCNVDFSSPL---GA 220
             ....:..||....|..|.....|.||..|           || |...:.:|..|...|.   |.
  Fly   395 NSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGT 459

  Fly   221 IITFKNIQRYVLIGI---------ATTNQKCKRASVYTDVLSHTDFIL 259
            ...|....||.:|||         .||     ...|||.|.|.:|:||
  Fly   460 SGVFGTSGRYTIIGIVAFGPTLCGVTT-----IPGVYTLVSSFSDWIL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 68/268 (25%)
Tryp_SPc 33..258 CDD:304450 68/268 (25%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 69/271 (25%)
Tryp_SPc 252..501 CDD:238113 68/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.