DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:62/263 - (23%)
Similarity:108/263 - (41%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLPVPGSSQYLDGRCGLLTNGKIANNISSPW-MAYLHTSELLYVCGGTVITEKLVLTAAHCTRAS 77
            |:|.|.....:.||   :|||..|.....|: :..|.:....:.|||::|....||||||||..:
  Fly    24 LVPTPVKDVKIQGR---ITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGA 85

  Fly    78 EQLVARIGEFIGTDDANDTMLSEYQVSQTFI-HSLYNTTTSANDIAILGLATDIVFSKTIRPICI 141
            ..:....|..:    .|....:.:..|..|: |..||:....|||::            ||...:
  Fly    86 SGVTINYGASL----RNQPQYTHWVGSGNFVQHHHYNSGNLHNDISL------------IRTPHV 134

  Fly   142 VWWTIWRK-----YIDNIQVLSG-----AQWGLPNDRNE-SDAFRITDIRRQPANMCSTLNGTAI 195
            .:|.:..|     |.|..|..:|     :.||...|.:. .|..:..|::....:.||  ...::
  Fly   135 DFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCS--RSWSL 197

  Fly   196 LSSQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKCKRA--SVYTDVLSHT 255
            ..:..|...:..| .|..|...||   :|.:..:   |:|:.:  ::..|:..  :|::.|..:.
  Fly   198 HDNMICINTNGGKSTCGGDSGGPL---VTHEGNR---LVGVTSFVSSAGCQSGAPAVFSRVTGYL 256

  Fly   256 DFI 258
            |:|
  Fly   257 DWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 55/242 (23%)
Tryp_SPc 33..258 CDD:304450 55/242 (23%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 57/248 (23%)
Tryp_SPc 38..262 CDD:238113 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.