DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:103/262 - (39%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLPVPGSSQYLDGRCGLLTNGKIANNISSPW-MAYLHTSELLYVCGGTVITEKLVLTAAHCTRAS 77
            |.|.|  .:.:.||   :|||..|.....|: :..|.:....:.|||::|....||||||||..:
  Fly    24 LTPTP--IKDIQGR---ITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGA 83

  Fly    78 EQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIV 142
            ..:....|..|.|.......:....:.|   |..||:....|||::            ||...:.
  Fly    84 SGVTINYGASIRTQPQYTHWVGSGDIIQ---HHHYNSGNLHNDISL------------IRTPHVD 133

  Fly   143 WWTIWRK-----YIDNIQVLSG-----AQWGLPNDRNE-SDAFRITDIRRQPANMCSTLNGTAIL 196
            :|::..|     |.|..|..:|     :.||...|.:. .|..:..|::....:.||  ...::.
  Fly   134 FWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCS--RTWSLH 196

  Fly   197 SSQFCAG-DSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQK--CKRA--SVYTDVLSHTD 256
            .:..|.. |.....|..|...||   :|....:   |:|:.:....  |:..  :|::.|..:.|
  Fly   197 DNMICINTDGGKSTCGGDSGGPL---VTHDGNR---LVGVTSFGSAAGCQSGAPAVFSRVTGYLD 255

  Fly   257 FI 258
            :|
  Fly   256 WI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 55/241 (23%)
Tryp_SPc 33..258 CDD:304450 55/241 (23%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.