DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG11841

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:290 Identity:74/290 - (25%)
Similarity:119/290 - (41%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISALLFLLPVPGSSQYLD---GRCGLLTNGKIANNISSPWMAYL-H---TSELLYVCGGTVITEK 65
            ::...|....|.:.:.:|   |...|:.:|..|.....|:.|.| |   .:|:.:.||||:|:.:
  Fly    46 VAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNR 110

  Fly    66 LVLTAAHC--TRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLAT 128
            ||||||||  :...|..|.|:||.....|.:|....::.|.....|..:......|||.|:.|..
  Fly   111 LVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDR 175

  Fly   129 DIVFSKTIRPICIVWWTIWRKYIDNIQVLS--GAQWGLPN-DRNESDAFRITDIRRQPANMCSTL 190
            ::.|::...|.|:       .:.|..|..|  ...||... .:.||.......::.......|::
  Fly   176 EVKFNRYKHPACL-------PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSV 233

  Fly   191 NGTAIL------SSQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQ-RYVLIGIATTNQKCKR--- 244
            :....|      .||.|.|..|:| .||.|...|:  :...|::. .|.::||.:....|..   
  Fly   234 DANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPV--LAYHKDLACMYHVMGITSAGITCSTPDI 296

  Fly   245 ASVYTDVLSHTDFILSVWRQYRNGEKSPKT 274
            .|.||.|....::|        .||.:.:|
  Fly   297 PSAYTRVHYFLNWI--------KGELAKQT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/244 (27%)
Tryp_SPc 33..258 CDD:304450 65/244 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 66/255 (26%)
Tryp_SPc 72..310 CDD:214473 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.