DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG10232

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:285 Identity:73/285 - (25%)
Similarity:109/285 - (38%) Gaps:79/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVPGSSQYLDGRCG------LLTNGKIANNISSPWMAYL-----HTSELLYVCGGTVITEKLVLT 69
            |.||:  .|...||      .:..|..|.....||||.|     ..|.:...|.|::|.::.|||
  Fly   238 PEPGN--VLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLT 300

  Fly    70 AAHCTRASEQLV--------ARIGEF-IGTDDAND------TMLSEYQVSQTFIHSLY-NTTTSA 118
            ||||. ..:::|        .|:||. |.|:...|      ....|..:....:|..| ||:...
  Fly   301 AAHCV-VKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFE 364

  Fly   119 NDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQV----LSGAQWGLPNDRNESDAF----- 174
            :|||::.|.|.:.::..|.|||:.        .|.|.:    |..|.||...:|..|...     
  Fly   365 SDIALVRLQTPVRYTHEILPICVP--------KDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTV 421

  Fly   175 ---------RITDIRRQPANMCSTLNGTAILSSQFCA-GDSDSKLCNVDFSSPLGAIITFKNIQR 229
                     :|:..|.:               ||.|| |......|..|...||  ::|..|..:
  Fly   422 YENRYYCQDKISFFRNE---------------SQICASGIRGEDSCEGDSGGPL--MLTLNNDYQ 469

  Fly   230 YV--LIGIAT-TNQKC--KRASVYT 249
            .:  |.||.: .::.|  ::..|||
  Fly   470 DIVYLAGIVSYGSENCGDRKPGVYT 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/262 (26%)
Tryp_SPc 33..258 CDD:304450 67/262 (26%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/261 (26%)
Tryp_SPc 260..503 CDD:214473 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.