DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and SPE

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:289 Identity:70/289 - (24%)
Similarity:119/289 - (41%) Gaps:62/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VPGSSQYLDGRCGLLTNGKIANNISS-----PWMAYLHTSELL-----YVCGGTVITEKLVLTAA 71
            :||:..     ||.|...:|....::     |||..|...:|.     :.|||.::..:.||||.
  Fly   121 LPGNDV-----CGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAG 180

  Fly    72 HCTRASEQL--------VARIGEF-IGTDDANDTMLS----------EYQVSQTFIHSLY--NTT 115
            ||. ||.:|        ..|:||: ..||....|.::          :.:|.:..||.:|  |:.
  Fly   181 HCL-ASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSV 244

  Fly   116 TSANDIAILGLATDIVFSKTIRPICI-VWWTIWRKYIDNIQVLSGAQWGLPNDRNES-------- 171
            ...||||::.|...:.::..:||||: ....:...::|....::|  |||..:...|        
  Fly   245 DQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAG--WGLTENMQPSAIKLKITV 307

  Fly   172 DAFRITDIRRQPANMCSTLNGTAILSSQFCAGDS---DSKLCNVDFSSPLGAIITFKNIQRYVLI 233
            :.:.:|..:.:.::....|:     .||.|||..   |:  |..|...||...|:......:.:.
  Fly   308 NVWNLTSCQEKYSSFKVKLD-----DSQMCAGGQLGVDT--CGGDSGGPLMVPISTGGRDVFYIA 365

  Fly   234 GIATTNQK-CKR---ASVYTDVLSHTDFI 258
            |:.:...| |..   ..|||...:..|:|
  Fly   366 GVTSYGTKPCGLKGWPGVYTRTGAFIDWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 64/271 (24%)
Tryp_SPc 33..258 CDD:304450 64/271 (24%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 65/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.